PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016437198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BES1
Protein Properties Length: 337aa    MW: 36135.1 Da    PI: 9.7649
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016437198.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82253.97.4e-172862236
          DUF822  2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaq 36
                    +++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaq
  XP_016437198.1 28 SGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQ 62
                    799******************************98 PP

2DUF822154.96.1e-486416928133
          DUF822  28 kiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpsp 122
                     kiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++  +e++g+sa+++p+ss + s+ ss++asp++sy++sp+sssfpsp
  XP_016437198.1  64 KIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCSRPAPMEIGGTSANITPSSSRHPSPPSSYFASPIPSYQPSPTSSSFPSP 158
                     9********************************************************************************************** PP

          DUF822 123 ssldsislasa 133
                     s+ d ++++++
  XP_016437198.1 159 SRGDANMSSHP 169
                     ****9988754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-122862IPR008540BES1/BZR1 plant transcription factor, N-terminal
PfamPF056877.1E-4463167IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MMWEGGGSPA TSSAGGGGGG AAVGSSSSGR RKPSWREREN NRRRERRRRA IAAKIYAGLR  60
AQXKIYAGLR AQGNYNLPKH CDNNEVLKAL CAEAGWIVEP DGTTYRKGCS RPAPMEIGGT  120
SANITPSSSR HPSPPSSYFA SPIPSYQPSP TSSSFPSPSR GDANMSSHPF AFLHNSIPSS  180
LPPLRISNSA PVTPPLSSPT RLPKQTFNLE TLARESMSAL NIPFFAASAP TSPTRGQRFT  240
PATIPECDES DSSTIDSGQW MSFQKYATNG VPTSPTFNLI KPAAQRIPSN DMIIDKGKSI  300
EFDFENVSVR AAWEGEKIHE VGLDDLELTL GSGSGRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12948RRKPSWRERENNRRRERRRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2474440.0KP247444.1 Nicotiana benthamiana BES1/BZR1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016437198.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like isoform X1
SwissprotQ8S3071e-111BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0F6VYB20.0A0A0F6VYB2_NICBE; BES1/BZR1
STRINGSolyc04g079980.2.11e-173(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-89BES1 family protein